PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_04460
Common NameKK1_004570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family TALE
Protein Properties Length: 371aa    MW: 41947.1 Da    PI: 6.9843
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_04460genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-092973331955
                    HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
       Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++++  LA+++gL+++q+ +WF N+R ++
  C.cajan_04460 297 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 333
                    45679*****************************885 PP

2ELK38.23.1e-13253273121
            ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                    ELK qLlrKY+gyLgsLkqEF
  C.cajan_04460 253 ELKGQLLRKYRGYLGSLKQEF 273
                    9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.6E-20119163IPR005540KNOX1
PfamPF037902.5E-22120159IPR005540KNOX1
SMARTSM012561.3E-25168219IPR005541KNOX2
PfamPF037911.1E-21171218IPR005541KNOX2
SMARTSM011885.9E-7253274IPR005539ELK domain
PROSITE profilePS5121311.139253273IPR005539ELK domain
PfamPF037895.8E-9253273IPR005539ELK domain
PROSITE profilePS5007113.167273336IPR001356Homeobox domain
SuperFamilySSF466895.13E-19275348IPR009057Homeodomain-like
SMARTSM003891.2E-12275340IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-28278338IPR009057Homeodomain-like
CDDcd000862.05E-12285337No hitNo description
PfamPF059206.7E-17293332IPR008422Homeobox KN domain
PROSITE patternPS000270311334IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MEGGSNEASS VMGFGENTRS SGVCPMMMMP LVTSHHAGHH PLNPNLNNPN PNPNEYTNTN  60
SLFLPMPCTN NNHRTNRNTT GNSSIFQDNN HNTNAALGYF MEIHHHNNNN DGSSSSSSSA  120
VKAKIMAHPH YHRLLAAYIN CQKVGAPPEV VARLEEACAS AAVTMAGGTA SIGEDPALDQ  180
FMEAYCEMLI KYEQELSKPF KEAMLFLQRI ECQFKSLTIS SSDTACNEGT DRNISSEDVD  240
VHNIIDPQAE DQELKGQLLR KYRGYLGSLK QEFTKKRKKG KLPKEARQQL LEWWSRHYKW  300
PYPSESQKLA LAESTGLDQK QINNWFINQR KRHWKPSEDM QFVVLDPSNP RYYMENVLAN  360
HFPMDLSHTM L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268277LKQEFTKKRK
2274278KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007153990.10.0hypothetical protein PHAVU_003G081800g
SwissprotP466081e-169HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A151SU490.0A0A151SU49_CAJCA; Homeobox protein SBH1
STRINGGLYMA07G39350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-128KNOX/ELK homeobox transcription factor